PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_001315-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 1179aa    MW: 131685 Da    PI: 8.0976
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_001315-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.21.8e-08771812346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT+e+  +++d  + +G++ +++Ia+ +   +t  +c+++++k
  AHYPO_001315-RA 771 SWTAEDKRIFIDKLAIHGKD-FRKIASFFD-QKTTADCVEFYYK 812
                      7*****************99.*********.9**********98 PP

2Myb_DNA-binding26.41.6e-08940981447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      WT  E  l+v+a+  +G++ +++I++++  +++  qck ++ k+
  AHYPO_001315-RA 940 WTDNEKSLFVQAFSSHGKD-FSLISQCVK-TKSIDQCKVFFSKV 981
                      *****************99.********9.********998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.24E-13755816IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-4766812IPR009057Homeodomain-like
PROSITE profilePS5129315.514767818IPR017884SANT domain
SMARTSM007173.7E-7768816IPR001005SANT/Myb domain
PfamPF002495.5E-6771812IPR001005SANT/Myb domain
PROSITE profilePS5129310.863935986IPR017884SANT domain
SMARTSM007171.6E-5936984IPR001005SANT/Myb domain
SuperFamilySSF466892.18E-10938986IPR009057Homeodomain-like
PfamPF002496.9E-7940980IPR001005SANT/Myb domain
CDDcd001672.51E-4940981No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1179 aa     Download sequence    Send to blast
MPPAPLSCDR NHLFRDRISS SRWRDSSSYY VGSRNFNNDN DFSPRWGFPS SHFHCAPGHV  60
KQGGWHMNYE DHEHSTHSFG DRFMDDDVFR PYGMHGDGRY VKFYRDNRPF YSHKNRRDHS  120
WEANHHHHRS PSNGGGRPRI VNDKRLISDS FMRISHMRSD PCDQFQKREQ TDKPSDANGS  180
SMGHKVDKKN LMGSYEWKPL KKSRSRSLTS RGSFFSHTSS SKGIKGESCD LPPKNATPVR  240
STSGDDVPCV ATVAPSEEPS SKKPRLGWGQ GLAKYEKKKV EGPEENVNKD GNAVLVTNVE  300
HLHSFTSNLV AKSPKVKDFS NCSSPATPSS FTCSSLPGLE DNSYGKAIDF DGNTTKFSVS  360
STSVPGSQLD GSNFSLDTME LNSITNLGSM LTELLQEDYK SSMDTSFTRS SALNRLLLWK  420
DDIAKALKLT ETEIESLENE LASLQANTSK SLQLPALSDS GLSDGVNVLH VPQLLVSNGD  480
IILENRLPCD EAKGVKVDVR DEDIDSPGTA TSKFVDPPVQ KFVSLELHKT SVETSTKSTM  540
ENLVACEDES DVGTSCQSCD KKVILDSDAI SGIVQPNVCE KEEGNLCDIV LASNKETADR  600
AAEFVLKLLP SCDYSLKPNG VYCLPAADTT VKKKFLNRKR FLRFKERVIS SKYRILHNLW  660
KEDLHLRSLK SYHGKPHKKL DLSSRSRQIR SHKHRSSTRS PAGSLSLVPT PGIIDFTGKL  720
ISDSKVKVYR NSLKMPAMIL DEKEKMSRIL LSNGLVEDPC AVEKERSLVN SWTAEDKRIF  780
IDKLAIHGKD FRKIASFFDQ KTTADCVEFY YKNHKLECFK KIKKLKGKNL GKPLSSSTYL  840
VTSEKKWSRE MNASSLDILG AASVIAAQAE QALETPKSLL RKPSHRKSNG LDGIKDASNQ  900
DWKQQKTGIK IKWRWTPEVT QNVDDSCSDE GCGEWDPADW TDNEKSLFVQ AFSSHGKDFS  960
LISQCVKTKS IDQCKVFFSK VRKCLGLDTI LFASGIGEIH SNNGTNRTGT NNEDAGIAET  1020
DSVFCTDKSG CRIDEDLLRV NSDVSMPEAY PELEENCGLG QLDHKYGCLE DDDLLPNADF  1080
PDVSDPRMFQ LVIMAFGMEP RYRQTFQHCQ IQLLLMAKYP TAFANHPISL RKLKQQSVQV  1140
TAMRNGNDCN MNSARVFSPR ESSSSNGSVV DYRSSARA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D8e-15735820994NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C8e-15735820994NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010669645.10.0PREDICTED: uncharacterized protein LOC104886820
TrEMBLA0A0K9QWA80.0A0A0K9QWA8_SPIOL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.12e-86MYB family protein